PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G405600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family LBD
Protein Properties Length: 188aa    MW: 20368.3 Da    PI: 7.4226
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G405600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601391.6e-4310108199
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrrkC  +C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear++dPvyG+vg i+ lq+++++l++
  Aqcoe5G405600.1.p  10 PCAACKFLRRKCMLGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARMKDPVYGCVGAISFLQREVHRLEK 101
                        7******************************************************************************************* PP

             DUF260  93 elallke 99 
                        el+++++
  Aqcoe5G405600.1.p 102 ELEAANA 108
                        **99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.4759110IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-4210107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MASSSSSNSP CAACKFLRRK CMLGCIFAPY FPPEEPQKFA NVHKIFGASN VTKLLNELLP  60
HQREDAVNSL AYEAEARMKD PVYGCVGAIS FLQREVHRLE KELEAANADL LRYACNEIPT  120
ALPSLPGTEM LPVISPHQRS VGFGRRIGID TGLYQTSGLQ LPYPPPWTHN SLGDSIDRVG  180
GGPGGNI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322187.21e-96hypothetical protein POPTR_0015s09370g
RefseqXP_011046208.11e-96PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_011046209.11e-96PREDICTED: protein LATERAL ORGAN BOUNDARIES
SwissprotQ9FML48e-71LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLB9IEW91e-96B9IEW9_POPTR; Uncharacterized protein
STRINGPOPTR_0015s09370.13e-96(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-68LBD family protein